PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK25622.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 546aa    MW: 62018.7 Da    PI: 4.585
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK25622.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.54.7e-11395436346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rW++ + el+++av+q G++ ++ I + ++ +Rt+kq+k+++ k
        PK25622.1 395 RWSKNDTELFYEAVQQIGTD-FSIIQQLFP-NRTRKQLKLKFKK 436
                      9*******************.*********.**********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159631.6E-28386468No hitNo description
SMARTSM007177.0E-8392440IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.3E-7393436IPR009057Homeodomain-like
SuperFamilySSF466896.95E-10394442IPR009057Homeodomain-like
CDDcd001675.36E-6395436No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 546 aa     Download sequence    Send to blast
XDIFSVLECL DDFITETTCD LGSETSKPQS KVHTDENLSF PAHPSFDSSS FTICDVAPSQ  60
ICSDYHSTQD PVSFSNTTVS DEPEEAQSND GRSKTMVAED LFDFEVYDGN VASGQCVGKF  120
QPNPKLGKGK KKPSTREPQA EVSSGVPYVH NVPQVNSVLE FPSEGDAEPT NFAKTTYSEV  180
VEDDPVVEEV GGKNIIGESS AEPNGLRRSQ RSSAAMQEIE EDLGQLLEEE DNDEEYRVDD  240
KSKKKKAIRK LEEPASGKEK PVRKRKSSKQ ASEEKIREPP KKFSHSTHRK KRIVDQALLD  300
MPEDEIDPQR LPIKDLILLA EHRERMAIKD AAKLKTPQTN QSADDSFRQG VSHNEEMFHS  360
EQGQNSDDEQ PTYSAQPSSS YVNYHSFMDK TPSTRWSKND TELFYEAVQQ IGTDFSIIQQ  420
LFPNRTRKQL KLKFKKEERQ HPLRLSDSLN NRSKDHSHFE SVIKILQELA AQAKQEAIGN  480
ESNWHPGEEE MEEPTRNTNE EHTKSELDVV VKDQEQKMEV TDLQKSPLKY DEGDDDPDRW  540
NNYDDY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1243265KKKAIRKLEEPASGKEKPVRKRK
2259265KPVRKRK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010105352.11e-159Transcription factor TFIIIB component B''
TrEMBLW9RZ721e-159W9RZ72_9R
STRINGVIT_03s0038g04460.t012e-84(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36662938
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.11e-43MYB_related family protein